PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0578s0054.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MIKC_MADS
Protein Properties Length: 240aa    MW: 27361 Da    PI: 7.0904
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0578s0054.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF87.67.1e-28959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         kri+n++ rqvtfskRrng+lKKA+EL +LCdaev viifsstg+ly++ss
  Cagra.0578s0054.1.p  9 KRINNSTSRQVTFSKRRNGLLKKAKELAILCDAEVGVIIFSSTGRLYDFSS 59
                         79***********************************************96 PP

2K-box83.93.5e-2876170498
                K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenka 93 
                          +s+++  +++ + +q+e+a Lk++++nLq+++R+++Ge+L+ Ls+ +Lq+Le+qLe sl+ +R kK+++l+e+i+el +  + +++en +
  Cagra.0578s0054.1.p  76 TSSENDPASEIQFWQKEAAILKRQLHNLQENHRQMMGEELSGLSVDDLQKLENQLELSLRGVRMKKDQMLIEEIQELNREGNLVHQENLD 165
                          45555678899******************************************************************************* PP

                K-box  94 Lrkkl 98 
                          L+kk+
  Cagra.0578s0054.1.p 166 LHKKV 170
                          ***98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.2E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.791161IPR002100Transcription factor, MADS-box
CDDcd002656.17E-44278No hitNo description
SuperFamilySSF554552.35E-32290IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004044.1E-28323IPR002100Transcription factor, MADS-box
PfamPF003192.9E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004044.1E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004044.1E-283859IPR002100Transcription factor, MADS-box
PfamPF014867.1E-2683170IPR002487Transcription factor, K-box
PROSITE profilePS5129716.03986176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010440Biological Processstomatal lineage progression
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MGRGKIAIKR INNSTSRQVT FSKRRNGLLK KAKELAILCD AEVGVIIFSS TGRLYDFSSS  60
SMKSVIERYT DAKGETSSEN DPASEIQFWQ KEAAILKRQL HNLQENHRQM MGEELSGLSV  120
DDLQKLENQL ELSLRGVRMK KDQMLIEEIQ ELNREGNLVH QENLDLHKKV NLMHQQNLEL  180
HEKVSEVEGV KITNKNSLLT NGLDMRDNSS EHVHLQLSQP QHDETHAKAI QLNYFSFIA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S6e-20171171Myocyte-specific enhancer factor 2B
1tqe_R6e-20171171Myocyte-specific enhancer factor 2B
1tqe_Q6e-20171171Myocyte-specific enhancer factor 2B
1tqe_P6e-20171171Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00410DAPTransfer from AT3G57230Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0300460.0BT030046.1 Arabidopsis thaliana At3g57230 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006291780.11e-176hypothetical protein CARUB_v10017951mg
SwissprotA2RVQ51e-168AGL16_ARATH; Agamous-like MADS-box protein AGL16
TrEMBLR0HL771e-176R0HL77_9BRAS; Uncharacterized protein
STRINGAT3G57230.11e-166(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53024105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57230.11e-169AGAMOUS-like 16